Lineage for d5ujka2 (5ujk A:146-316)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206813Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2206814Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2207384Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2207385Protein automated matches [226850] (29 species)
    not a true protein
  7. 2207498Species Methylobacterium extorquens [TaxId:419610] [261962] (3 PDB entries)
  8. 2286343Domain d5ujka2: 5ujk A:146-316 [329644]
    Other proteins in same PDB: d5ujka1
    automated match to d4rora2
    complexed with ca, cl, nad

Details for d5ujka2

PDB Entry: 5ujk (more details), 1.53 Å

PDB Description: malate dehydrogenase from methylobacterium extorquens, complexed with nad
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5ujka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujka2 d.162.1.0 (A:146-316) automated matches {Methylobacterium extorquens [TaxId: 419610]}
gvldsarfrhflaeefgvsvedvtafvlgghgddmvpltrystvagvpltdlvklgwttq
ekldamvertrkgggeivnllktgsafyapaasaiamaesylrdkkrvlpcaayldgqyg
idglyvgvpvvigengvervlevtfnddekamfeksvnsvkglieacksvn

SCOPe Domain Coordinates for d5ujka2:

Click to download the PDB-style file with coordinates for d5ujka2.
(The format of our PDB-style files is described here.)

Timeline for d5ujka2:

  • d5ujka2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5ujka1