SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ujka2 (5ujk A:146-316)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206813Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2206814Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2207384Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2207385Protein automated matches [226850] (29 species)
    not a true protein
  7. 2207498Species Methylobacterium extorquens [TaxId:419610] [261962] (3 PDB entries)
  8. 2286343Domain d5ujka2: 5ujk A:146-316 [329644]
    Other proteins in same PDB: d5ujka1
    automated match to d4rora2
    complexed with ca, cl, nad

Details for d5ujka2

PDB Entry: 5ujk (more details), 1.53 Å

PDB Description: malate dehydrogenase from methylobacterium extorquens, complexed with nad
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5ujka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujka2 d.162.1.0 (A:146-316) automated matches {Methylobacterium extorquens [TaxId: 419610]}
gvldsarfrhflaeefgvsvedvtafvlgghgddmvpltrystvagvpltdlvklgwttq
ekldamvertrkgggeivnllktgsafyapaasaiamaesylrdkkrvlpcaayldgqyg
idglyvgvpvvigengvervlevtfnddekamfeksvnsvkglieacksvn

SCOPe Domain Coordinates for d5ujka2:

Click to download the PDB-style file with coordinates for d5ujka2.
(The format of our PDB-style files is described here.)

Timeline for d5ujka2:

  • d5ujka2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5ujka1