Lineage for d5ujka1 (5ujk A:2-145)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095360Species Methylobacterium extorquens [TaxId:419610] [261958] (3 PDB entries)
  8. 2286342Domain d5ujka1: 5ujk A:2-145 [329643]
    Other proteins in same PDB: d5ujka2
    automated match to d4rora1
    complexed with ca, cl, nad

Details for d5ujka1

PDB Entry: 5ujk (more details), 1.53 Å

PDB Description: malate dehydrogenase from methylobacterium extorquens, complexed with nad
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5ujka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujka1 c.2.1.0 (A:2-145) automated matches {Methylobacterium extorquens [TaxId: 419610]}
arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys
gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn
pldamvwalqkfsglptnkvvgma

SCOPe Domain Coordinates for d5ujka1:

Click to download the PDB-style file with coordinates for d5ujka1.
(The format of our PDB-style files is described here.)

Timeline for d5ujka1:

  • d5ujka1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5ujka2