Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) |
Protein Glutathione S-transferase [52863] (22 species) |
Species Human (Homo sapiens), class alpha (a1-1) [TaxId:9606] [52870] (7 PDB entries) |
Domain d1gsdb2: 1gsd B:2-80 [32964] Other proteins in same PDB: d1gsda1, d1gsdb1 |
PDB Entry: 1gsd (more details), 2.5 Å
SCOP Domain Sequences for d1gsdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsdb2 c.47.1.5 (B:2-80) Glutathione S-transferase {Human (Homo sapiens), class alpha (a1-1)} aekpklhyfnargrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid gmklvqtrailnyiaskyn
Timeline for d1gsdb2: