Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d5u17f_: 5u17 F: [329636] Other proteins in same PDB: d5u17a1, d5u17a2, d5u17b1, d5u17b2, d5u17c1, d5u17c2, d5u17c3, d5u17d1, d5u17d2, d5u17e1, d5u17e2, d5u17g1, d5u17g2 automated match to d1xh3b_ complexed with 7wp, act, gol, na |
PDB Entry: 5u17 (more details), 2.15 Å
SCOPe Domain Sequences for d5u17f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u17f_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d5u17f_: