SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u2fa_ (5u2f A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (8 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (589 PDB entries)
  8. 2286334Domain d5u2fa_: 5u2f A: [329635]
    automated match to d4alga_
    complexed with 82y

Details for d5u2fa_

PDB Entry: 5u2f (more details), 2.53 Å

PDB Description: brd4 first bromodomain (bd1) in complex with dual pi3 kinase (pi3k) inhibitor sf2558ha
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2fa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiik
tpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkin
elpteeteimi

SCOPe Domain Coordinates for d5u2fa_:

Click to download the PDB-style file with coordinates for d5u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d5u2fa_:

  • d5u2fa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09