Lineage for d5u2fa_ (5u2f A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (10 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 2286334Domain d5u2fa_: 5u2f A: [329635]
    automated match to d4alga_
    complexed with 82y

Details for d5u2fa_

PDB Entry: 5u2f (more details), 2.53 Å

PDB Description: brd4 first bromodomain (bd1) in complex with dual pi3 kinase (pi3k) inhibitor sf2558ha
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5u2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u2fa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiik
tpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkin
elpteeteimi

SCOPe Domain Coordinates for d5u2fa_:

Click to download the PDB-style file with coordinates for d5u2fa_.
(The format of our PDB-style files is described here.)

Timeline for d5u2fa_:

  • d5u2fa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09