Lineage for d5ujoa_ (5ujo A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218486Protein automated matches [190161] (23 species)
    not a true protein
  7. 2218543Species Escherichia coli [TaxId:562] [187306] (62 PDB entries)
  8. 2286333Domain d5ujoa_: 5ujo A: [329634]
    automated match to d1ylta_
    complexed with 8cy, k, lsi

Details for d5ujoa_

PDB Entry: 5ujo (more details), 1.35 Å

PDB Description: x-ray crystal structure of ruthenocenyl-7- aminodesacetoxycephalosporanic acid covalent acyl-enyzme complex with ctx-m-14 e166a beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5ujoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujoa_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqp
qqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d5ujoa_:

Click to download the PDB-style file with coordinates for d5ujoa_.
(The format of our PDB-style files is described here.)

Timeline for d5ujoa_:

  • d5ujoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09