SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ujwb_ (5ujw B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2286293Species Francisella tularensis [TaxId:177416] [329594] (1 PDB entry)
  8. 2286329Domain d5ujwb_: 5ujw B: [329630]
    automated match to d4bi7a_
    complexed with 13p, cit, edo, ipa

Details for d5ujwb_

PDB Entry: 5ujw (more details), 2.65 Å

PDB Description: crystal structure of triosephosphate isomerase from francisella tularensis subsp. tularensis schu s4
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d5ujwb_:

Sequence, based on SEQRES records: (download)

>d5ujwb_ c.1.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
mqklimgnwkmngnstsikelcsgisqvqydtsrvaiavfpssvyvkevisqlpekvgvg
lqnitfyddgaytgeisarmledigcdyllighserrslfaesdedvfkklnkiidttit
pvvcigeslddrqsgklkqvlatqlslilenlsveqlakvviayepvwaigtgvvasleq
iqethqfirsllakvderlaknikivyggslkaenakdilslpdvdggliggaslkaaef
neiinqank

Sequence, based on observed residues (ATOM records): (download)

>d5ujwb_ c.1.1.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
mqklimgnwkmngnstsikelcsgisqtsrvaiavfpssvyvkevisqlpekvgvglqni
tfyddgaytgeisarmledigcdyllighserrslfaesdedvfkklnkiidttitpvvc
igeslddrqsgklkqvlatqlslilenlsveqlakvviayepvwatgvvasleqiqethq
firsllakvderlaknikivyggslkaenakdilslpdvdggliggaslkaaefneiinq
ank

SCOPe Domain Coordinates for d5ujwb_:

Click to download the PDB-style file with coordinates for d5ujwb_.
(The format of our PDB-style files is described here.)

Timeline for d5ujwb_:

  • d5ujwb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09