SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ujob_ (5ujo B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218486Protein automated matches [190161] (23 species)
    not a true protein
  7. 2218543Species Escherichia coli [TaxId:562] [187306] (62 PDB entries)
  8. 2286328Domain d5ujob_: 5ujo B: [329629]
    automated match to d1ylta_
    complexed with 8cy, k, lsi

Details for d5ujob_

PDB Entry: 5ujo (more details), 1.35 Å

PDB Description: x-ray crystal structure of ruthenocenyl-7- aminodesacetoxycephalosporanic acid covalent acyl-enyzme complex with ctx-m-14 e166a beta-lactamase
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5ujob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ujob_ e.3.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
avqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetqk
qllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpggv
tafaraigdetfrldrtaptlntaipgdprdtttpramaqtlrqltlghalgetqraqlv
twlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpqq
naesrrdvlasaariiaegl

SCOPe Domain Coordinates for d5ujob_:

Click to download the PDB-style file with coordinates for d5ujob_.
(The format of our PDB-style files is described here.)

Timeline for d5ujob_:

  • d5ujob_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09