Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d5u17a1: 5u17 A:1-178 [329627] Other proteins in same PDB: d5u17a2, d5u17b1, d5u17b2, d5u17c2, d5u17c3, d5u17d1, d5u17d2, d5u17e1, d5u17e2, d5u17f_, d5u17g1, d5u17g2, d5u17h_ automated match to d4l4va1 complexed with 7wp, act, gol, na |
PDB Entry: 5u17 (more details), 2.15 Å
SCOPe Domain Sequences for d5u17a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5u17a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d5u17a1: