Lineage for d5u17a1 (5u17 A:1-178)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183700Domain d5u17a1: 5u17 A:1-178 [329627]
    Other proteins in same PDB: d5u17a2, d5u17b1, d5u17b2, d5u17c2, d5u17c3, d5u17d1, d5u17d2, d5u17e1, d5u17e2, d5u17f_, d5u17g1, d5u17g2, d5u17h_
    automated match to d4l4va1
    complexed with 7wp, act, gol, na

Details for d5u17a1

PDB Entry: 5u17 (more details), 2.15 Å

PDB Description: structure of human mr1-da-6-fp in complex with human mait a-f7 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5u17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u17a1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5u17a1:

Click to download the PDB-style file with coordinates for d5u17a1.
(The format of our PDB-style files is described here.)

Timeline for d5u17a1: