Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries) Uniprot P08263 |
Domain d1gseb2: 1gse B:2-80 [32962] Other proteins in same PDB: d1gsea1, d1gseb1 complexed with bme, eaa, gsh; mutant |
PDB Entry: 1gse (more details), 2 Å
SCOPe Domain Sequences for d1gseb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gseb2 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} aekpklhyfnargkmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid gmklvqtrailnyiaskyn
Timeline for d1gseb2: