SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5macc1 (5mac C:1-139)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (18 species)
    not a true protein
  7. 2286205Species Methanococcoides burtonii [TaxId:29291] [329506] (1 PDB entry)
  8. 2286300Domain d5macc1: 5mac C:1-139 [329601]
    automated match to d3a13d1
    complexed with cap, cl, mg

Details for d5macc1

PDB Entry: 5mac (more details), 2.6 Å

PDB Description: crystal structure of decameric methanococcoides burtonii rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (C:) Ribulose-1,5-bisphosphate carboxylase-oxygenase type III

SCOPe Domain Sequences for d5macc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5macc1 d.58.9.0 (C:1-139) automated matches {Methanococcoides burtonii [TaxId: 29291]}
msliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesst
gtnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmk
eiqalklmdiwfppsmleq

SCOPe Domain Coordinates for d5macc1:

Click to download the PDB-style file with coordinates for d5macc1.
(The format of our PDB-style files is described here.)

Timeline for d5macc1:

  • d5macc1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09