Lineage for d5ugec_ (5uge C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (865 PDB entries)
  8. 2286299Domain d5ugec_: 5uge C: [329600]
    automated match to d3op5a_
    complexed with 584, po4

Details for d5ugec_

PDB Entry: 5uge (more details), 1.8 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to bi- d1870
PDB Compounds: (C:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d5ugec_:

Sequence, based on SEQRES records: (download)

>d5ugec_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngplftelkfyqr
aakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyeanakrf
srktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegv
hkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpk
yvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglk
aigskddgkldl

Sequence, based on observed residues (ATOM records): (download)

>d5ugec_ d.144.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdmaaaawkvglpigqciyladmndapcvvkvepsgplftelkfyqraakpeqiqkwirt
rklkylgvpkywgsglhsyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildiley
iheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtief
tsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmd
kcfpaanapgeiakymetvklldytekplyenlrdillqglkaigskddgkldl

SCOPe Domain Coordinates for d5ugec_:

Click to download the PDB-style file with coordinates for d5ugec_.
(The format of our PDB-style files is described here.)

Timeline for d5ugec_:

  • d5ugec_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09