SCOP 1.67: Domain d1c72d2: 1c72 D:1-84

Lineage for d1c72d2 (1c72 D:1-84)

Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
Superfamily c.47.1: Thioredoxin-like [52833] (14 families)
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
Protein Class mu GST [81359] (3 species)
Species Chicken (Gallus gallus) [TaxId:9031] [52869] (2 PDB entries)
Domain d1c72d2: 1c72 D:1-84 [32960]
Other proteins in same PDB: d1c72a1, d1c72b1, d1c72c1, d1c72d1
complexed with epy

Details for d1c72d2

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

SCOP Domain Sequences for d1c72d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72d2 c.47.1.5 (D:1-84) Class mu GST {Chicken (Gallus gallus)}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOP Domain Coordinates for d1c72d2:

Click to download the PDB-style file with coordinates for d1c72d2.
(The format of our PDB-style files is described here.)

Timeline for d1c72d2: