Lineage for d5ulva2 (5ulv A:146-319)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206813Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2206814Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2207384Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2207385Protein automated matches [226850] (29 species)
    not a true protein
  7. 2286297Species Methylobacterium extorquens [TaxId:408] [329598] (1 PDB entry)
  8. 2286298Domain d5ulva2: 5ulv A:146-319 [329599]
    Other proteins in same PDB: d5ulva1
    automated match to d4rora2
    complexed with ca

Details for d5ulva2

PDB Entry: 5ulv (more details), 1.66 Å

PDB Description: malate dehydrogenase from methylobacterium extorquens
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5ulva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ulva2 d.162.1.0 (A:146-319) automated matches {Methylobacterium extorquens [TaxId: 408]}
gvldsarfrhflaeefgvsvedvtafvlgghgddmvpltrystvagvpltdlvklgwttq
ekldamvertrkgggeivnllktgsafyapaasaiamaesylrdkkrvlpcaayldgqyg
idglyvgvpvvigengvervlevtfnddekamfeksvnsvkglieacksvndkl

SCOPe Domain Coordinates for d5ulva2:

Click to download the PDB-style file with coordinates for d5ulva2.
(The format of our PDB-style files is described here.)

Timeline for d5ulva2:

  • d5ulva2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5ulva1