SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ulva1 (5ulv A:2-145)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (226 species)
    not a true protein
  7. 2286295Species Methylobacterium extorquens [TaxId:408] [329596] (1 PDB entry)
  8. 2286296Domain d5ulva1: 5ulv A:2-145 [329597]
    Other proteins in same PDB: d5ulva2
    automated match to d4rora1
    complexed with ca

Details for d5ulva1

PDB Entry: 5ulv (more details), 1.66 Å

PDB Description: malate dehydrogenase from methylobacterium extorquens
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5ulva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ulva1 c.2.1.0 (A:2-145) automated matches {Methylobacterium extorquens [TaxId: 408]}
arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys
gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn
pldamvwalqkfsglptnkvvgma

SCOPe Domain Coordinates for d5ulva1:

Click to download the PDB-style file with coordinates for d5ulva1.
(The format of our PDB-style files is described here.)

Timeline for d5ulva1:

  • d5ulva1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5ulva2