Lineage for d5ujwa_ (5ujw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2286293Species Francisella tularensis [TaxId:177416] [329594] (1 PDB entry)
  8. 2286294Domain d5ujwa_: 5ujw A: [329595]
    automated match to d4bi7a_
    complexed with 13p, cit, edo, ipa

Details for d5ujwa_

PDB Entry: 5ujw (more details), 2.65 Å

PDB Description: crystal structure of triosephosphate isomerase from francisella tularensis subsp. tularensis schu s4
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d5ujwa_:

Sequence, based on SEQRES records: (download)

>d5ujwa_ c.1.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
qklimgnwkmngnstsikelcsgisqvqydtsrvaiavfpssvyvkevisqlpekvgvgl
qnitfyddgaytgeisarmledigcdyllighserrslfaesdedvfkklnkiidttitp
vvcigeslddrqsgklkqvlatqlslilenlsveqlakvviayepvwaigtgvvasleqi
qethqfirsllakvderlaknikivyggslkaenakdilslpdvdggliggaslkaaefn
eiinqankicte

Sequence, based on observed residues (ATOM records): (download)

>d5ujwa_ c.1.1.0 (A:) automated matches {Francisella tularensis [TaxId: 177416]}
qklimgnwkmngnstsikelcsgisqtsrvaiavfpssvyvkevisqlpekvgvglqnit
fyddgaytgeisarmledigcdyllighserrslfaesdedvfkklnkiidtitpvvcig
eslddrqsgklkqvlatqlslilenlsveqlakvviayepvwaigtgvvasleqiqethq
firsllakvderlaknikivyggslkaenakdilslpdvdggliggaslkaaefneiinq
ankicte

SCOPe Domain Coordinates for d5ujwa_:

Click to download the PDB-style file with coordinates for d5ujwa_.
(The format of our PDB-style files is described here.)

Timeline for d5ujwa_:

  • d5ujwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09