SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ugea_ (5uge A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (768 PDB entries)
  8. 2286288Domain d5ugea_: 5uge A: [329589]
    automated match to d3op5a_
    complexed with 584, po4

Details for d5ugea_

PDB Entry: 5uge (more details), 1.8 Å

PDB Description: crystal structure of the human vaccinia-related kinase bound to bi- d1870
PDB Compounds: (A:) Serine/threonine-protein kinase VRK1

SCOPe Domain Sequences for d5ugea_:

Sequence, based on SEQRES records: (download)

>d5ugea_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigqggfgciyladmnssesvgsdapcvvkvepsdngp
lftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlq
kiyeanakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyg
layrycpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghl
pwednlkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyen
lrdillqglkaigskddgkldl

Sequence, based on observed residues (ATOM records): (download)

>d5ugea_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aeqfavgeiitdmaaaawkvglpigciyladmnssesvgsdapcvvkvepsdngplftel
kfyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyea
nakrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayry
cpegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwedn
lkdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdil
lqglkaigskddgkldl

SCOPe Domain Coordinates for d5ugea_:

Click to download the PDB-style file with coordinates for d5ugea_.
(The format of our PDB-style files is described here.)

Timeline for d5ugea_:

  • d5ugea_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09