Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein Inorganic pyrophosphatase [50326] (9 species) eukaryotic enzyme has additional secondary structures at both N- and C-termini |
Species Thermococcus thioreducens [TaxId:277988] [346243] (2 PDB entries) |
Domain d5ucqa_: 5ucq A: [329588] automated match to d3q5va_ complexed with ca, edo, mrd, na, pop |
PDB Entry: 5ucq (more details), 1.4 Å
SCOPe Domain Sequences for d5ucqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ucqa_ b.40.5.1 (A:) Inorganic pyrophosphatase {Thermococcus thioreducens [TaxId: 277988]} mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg
Timeline for d5ucqa_: