SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ucqa_ (5ucq A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2052342Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2052343Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2052432Protein automated matches [191079] (4 species)
    not a true protein
  7. 2052445Species Thermococcus thioreducens [TaxId:277988] [189009] (10 PDB entries)
  8. 2286287Domain d5ucqa_: 5ucq A: [329588]
    automated match to d3q5va_
    complexed with ca, edo, mrd, na, pop

Details for d5ucqa_

PDB Entry: 5ucq (more details), 1.4 Å

PDB Description: the structure of archaeal inorganic pyrophosphatase in complex with pyrophosphate
PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d5ucqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucqa_ b.40.5.1 (A:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d5ucqa_:

Click to download the PDB-style file with coordinates for d5ucqa_.
(The format of our PDB-style files is described here.)

Timeline for d5ucqa_:

  • d5ucqa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09