SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ubtb_ (5ubt B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2239862Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2240026Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 2240027Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 protein domains)
  6. 2240031Protein automated matches [310859] (2 species)
    not a true protein
  7. 2240032Species Cow (Bos taurus) [TaxId:9913] [311310] (4 PDB entries)
  8. 2286286Domain d5ubtb_: 5ubt B: [329587]
    automated match to d5dxub_
    complexed with 85s

Details for d5ubtb_

PDB Entry: 5ubt (more details), 2.83 Å

PDB Description: crystal structure of pi3k delta in complex with a 7-(3-(piperazin-1- yl)phenyl)pyrrolo[2,1-f][1,2,4] triazin-4-amine deriviatine
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d5ubtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ubtb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifee
qcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaaey
reidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

SCOPe Domain Coordinates for d5ubtb_:

Click to download the PDB-style file with coordinates for d5ubtb_.
(The format of our PDB-style files is described here.)

Timeline for d5ubtb_:

  • d5ubtb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09