Lineage for d5ucqc_ (5ucq C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2384029Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2384030Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 protein domains)
    barrel, closed; n=5, S=8
  6. 2384031Protein Inorganic pyrophosphatase [50326] (9 species)
    eukaryotic enzyme has additional secondary structures at both N- and C-termini
  7. 2384126Species Thermococcus thioreducens [TaxId:277988] [346243] (2 PDB entries)
  8. 2384129Domain d5ucqc_: 5ucq C: [329586]
    automated match to d3q5va_
    complexed with ca, edo, mrd, na, pop

Details for d5ucqc_

PDB Entry: 5ucq (more details), 1.4 Å

PDB Description: the structure of archaeal inorganic pyrophosphatase in complex with pyrophosphate
PDB Compounds: (C:) inorganic pyrophosphatase

SCOPe Domain Sequences for d5ucqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ucqc_ b.40.5.1 (C:) Inorganic pyrophosphatase {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d5ucqc_:

Click to download the PDB-style file with coordinates for d5ucqc_.
(The format of our PDB-style files is described here.)

Timeline for d5ucqc_: