Lineage for d5u08a_ (5u08 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (43 species)
    not a true protein
  7. 2534105Species Uncultured bacterium [TaxId:77133] [314792] (6 PDB entries)
  8. 2534108Domain d5u08a_: 5u08 A: [329581]
    automated match to d5hmnc_
    complexed with act, ca, mg, sis

Details for d5u08a_

PDB Entry: 5u08 (more details), 1.52 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase env0020 from an uncultured soil metagenomic sample in complex with sisomicin
PDB Compounds: (A:) aac3-I

SCOPe Domain Sequences for d5u08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u08a_ d.108.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
eidnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvalle
nkivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfv
qadkvddyaldfarstkptaeeqvvhfyytlk

SCOPe Domain Coordinates for d5u08a_:

Click to download the PDB-style file with coordinates for d5u08a_.
(The format of our PDB-style files is described here.)

Timeline for d5u08a_: