SCOP 1.61: Domain d1c72b2: 1c72 B:1-84

Lineage for d1c72b2 (1c72 B:1-84)

Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
Superfamily c.47.1: Thioredoxin-like [52833] (12 families)
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
Protein Glutathione S-transferase [52863] (27 species)
Species Chicken (Gallus gallus), class mu [52869] (2 PDB entries)
Domain d1c72b2: 1c72 B:1-84 [32958]
Other proteins in same PDB: d1c72a1, d1c72b1, d1c72c1, d1c72d1

Details for d1c72b2

PDB Entry: 1c72 (more details), 2.8 Å

PDB Description: tyr115, gln165 and trp209 contribute to the 1,2-epoxy-3-(p-nitrophenoxy)propane conjugating activities of glutathione s-transferase cgstm1-1

SCOP Domain Sequences for d1c72b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c72b2 c.47.1.5 (B:1-84) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOP Domain Coordinates for d1c72b2:

Click to download the PDB-style file with coordinates for d1c72b2.
(The format of our PDB-style files is described here.)

Timeline for d1c72b2: