SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5u08b_ (5u08 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (37 species)
    not a true protein
  7. 2271491Species Uncultured bacterium [TaxId:77133] [314792] (2 PDB entries)
  8. 2286277Domain d5u08b_: 5u08 B: [329578]
    automated match to d5hmnc_
    complexed with act, ca, mg, sis

Details for d5u08b_

PDB Entry: 5u08 (more details), 1.52 Å

PDB Description: crystal structure of an aminoglycoside acetyltransferase env0020 from an uncultured soil metagenomic sample in complex with sisomicin
PDB Compounds: (B:) aac3-I

SCOPe Domain Sequences for d5u08b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u08b_ d.108.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
dnflkierlaendlpkfiqlirlfeavfemknfsipdsehlqkllnqnnfyvfvallenk
ivggltsyvleqyysekplayiydlavdtnwqrqgigkklitatnqfytekgfeevfvqa
dkvddyaldfarstkptaeeqvvhfyytlk

SCOPe Domain Coordinates for d5u08b_:

Click to download the PDB-style file with coordinates for d5u08b_.
(The format of our PDB-style files is described here.)

Timeline for d5u08b_:

  • d5u08b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09