Lineage for d5u72b2 (5u72 B:111-200)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (657 PDB entries)
  8. 2286276Domain d5u72b2: 5u72 B:111-200 [329577]
    Other proteins in same PDB: d5u72a1, d5u72a2, d5u72a3, d5u72b1, d5u72c1, d5u72c2, d5u72c3, d5u72d1, d5u72e1, d5u72e2, d5u72f_, d5u72g1, d5u72g2, d5u72h_
    automated match to d2f54d2
    complexed with 7zv, act, dms, gol

Details for d5u72b2

PDB Entry: 5u72 (more details), 2.5 Å

PDB Description: structure of human mr1-5oh-dcf in complex with human mait a-f7 tcr
PDB Compounds: (B:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d5u72b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5u72b2 b.1.1.2 (B:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d5u72b2:

Click to download the PDB-style file with coordinates for d5u72b2.
(The format of our PDB-style files is described here.)

Timeline for d5u72b2:

  • d5u72b2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09