SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m1ab1 (5m1a B:27-138)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162394Family d.17.4.5: Penicillin binding protein 2a (PBP2A), N-terminal domain [82595] (1 protein)
    some sequence similarity to KSI
    automatically mapped to Pfam PF05223
  6. 2162395Protein Penicillin binding protein 2a (PBP2A), N-terminal domain [82596] (1 species)
  7. 2162396Species Staphylococcus aureus [TaxId:1280] [82597] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2286272Domain d5m1ab1: 5m1a B:27-138 [329573]
    Other proteins in same PDB: d5m1aa2, d5m1aa3, d5m1ab2, d5m1ab3
    automated match to d1vqqa1
    complexed with cd, mur

Details for d5m1ab1

PDB Entry: 5m1a (more details), 2 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of ceftazidime ligand
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m1ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m1ab1 d.17.4.5 (B:27-138) Penicillin binding protein 2a (PBP2A), N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik
kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk

SCOPe Domain Coordinates for d5m1ab1:

Click to download the PDB-style file with coordinates for d5m1ab1.
(The format of our PDB-style files is described here.)

Timeline for d5m1ab1:

  • d5m1ab1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09