Lineage for d5m29a_ (5m29 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143341Family c.92.2.2: TroA-like [53811] (6 protein domains)
  6. 2143368Protein automated matches [191053] (5 species)
    not a true protein
  7. 2286203Species Escherichia coli [TaxId:83333] [329504] (3 PDB entries)
  8. 2286269Domain d5m29a_: 5m29 A: [329570]
    automated match to d1n2za_
    complexed with cby, cyn, gol

Details for d5m29a_

PDB Entry: 5m29 (more details), 1.5 Å

PDB Description: structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli
PDB Compounds: (A:) Vitamin B12-binding protein

SCOPe Domain Sequences for d5m29a_:

Sequence, based on SEQRES records: (download)

>d5m29a_ c.92.2.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd

Sequence, based on observed residues (ATOM records): (download)

>d5m29a_ c.92.2.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstwqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitgkipvipltsdwferaspriilaaqqlcnalsqvd

SCOPe Domain Coordinates for d5m29a_:

Click to download the PDB-style file with coordinates for d5m29a_.
(The format of our PDB-style files is described here.)

Timeline for d5m29a_:

  • d5m29a_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09