Lineage for d5lg4a1 (5lg4 A:36-227)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997864Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 1997877Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 1997878Family a.47.2.1: t-snare proteins [47662] (6 protein domains)
  6. 1997902Protein automated matches [191190] (4 species)
    not a true protein
  7. 2286207Species Saccharomyces cerevisiae [TaxId:559292] [329508] (2 PDB entries)
  8. 2286262Domain d5lg4a1: 5lg4 A:36-227 [329563]
    Other proteins in same PDB: d5lg4a2
    automated match to d1fioa_
    complexed with so4

Details for d5lg4a1

PDB Entry: 5lg4 (more details), 2.9 Å

PDB Description: crystal structure of the sec3/sso2 complex at 2.9 angstrom resolution
PDB Compounds: (A:) Protein SSO2

SCOPe Domain Sequences for d5lg4a1:

Sequence, based on SEQRES records: (download)

>d5lg4a1 a.47.2.1 (A:36-227) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
dfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqatdlq
yqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqytii
qpeatdeeveaaindvngqqifsqallnanrrgeaktalaevqarhqellklektmaelt
qlfndmeelvie

Sequence, based on observed residues (ATOM records): (download)

>d5lg4a1 a.47.2.1 (A:36-227) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
dfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqatdlq
yqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqytii
qpeatdeeveaaindvngqqifsqallaktalaevqarhqellklektmaeltqlfndme
elvie

SCOPe Domain Coordinates for d5lg4a1:

Click to download the PDB-style file with coordinates for d5lg4a1.
(The format of our PDB-style files is described here.)

Timeline for d5lg4a1:

  • d5lg4a1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09