![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
![]() | Protein automated matches [254721] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [316254] (5 PDB entries) |
![]() | Domain d5tr2b3: 5tr2 B:305-421 [329560] Other proteins in same PDB: d5tr2a4, d5tr2a5, d5tr2b4 automated match to d5f9ca3 complexed with ca, gol, so4 |
PDB Entry: 5tr2 (more details), 2.5 Å
SCOPe Domain Sequences for d5tr2b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tr2b3 c.84.1.0 (B:305-421) automated matches {Human (Homo sapiens) [TaxId: 9606]} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvasatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwqkyg
Timeline for d5tr2b3: