Lineage for d1gsub2 (1gsu B:1-84)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24237Species Chicken (Gallus gallus), class mu [52869] (2 PDB entries)
  8. 24239Domain d1gsub2: 1gsu B:1-84 [32956]
    Other proteins in same PDB: d1gsua1, d1gsub1

Details for d1gsub2

PDB Entry: 1gsu (more details), 1.94 Å

PDB Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution

SCOP Domain Sequences for d1gsub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gsub2 c.47.1.5 (B:1-84) Glutathione S-transferase {Chicken (Gallus gallus), class mu}
vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
ylidgdvkltqsnailryiarkhn

SCOP Domain Coordinates for d1gsub2:

Click to download the PDB-style file with coordinates for d1gsub2.
(The format of our PDB-style files is described here.)

Timeline for d1gsub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsub1