SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tr2b2 (5tr2 B:192-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141779Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2141780Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2141872Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2141873Protein automated matches [254721] (3 species)
    not a true protein
  7. 2272953Species Homo sapiens [TaxId:9606] [316254] (5 PDB entries)
  8. 2286258Domain d5tr2b2: 5tr2 B:192-304 [329559]
    Other proteins in same PDB: d5tr2a4, d5tr2a5, d5tr2b4
    automated match to d5f9ca2
    complexed with ca, gol, so4

Details for d5tr2b2

PDB Entry: 5tr2 (more details), 2.5 Å

PDB Description: crystal structure of the d263g missense variant of human pgm1
PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5tr2b2:

Sequence, based on SEQRES records: (download)

>d5tr2b2 c.84.1.0 (B:192-304) automated matches {Homo sapiens [TaxId: 9606]}
veayatmlrsifdfsalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpgpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

Sequence, based on observed residues (ATOM records): (download)

>d5tr2b2 c.84.1.0 (B:192-304) automated matches {Homo sapiens [TaxId: 9606]}
veayatmlrsifdfsalkellsrlkiridamhgvvgpyvkkilceelgapansavncvpl
edfgghhpgpnyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOPe Domain Coordinates for d5tr2b2:

Click to download the PDB-style file with coordinates for d5tr2b2.
(The format of our PDB-style files is described here.)

Timeline for d5tr2b2:

  • d5tr2b2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09