SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hyva3 (5hyv A:532-677)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120181Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2120182Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2120348Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2120349Protein automated matches [226991] (7 species)
    not a true protein
  7. 2285550Species Scheffersomyces stipitis [TaxId:322104] [328851] (7 PDB entries)
  8. 2286251Domain d5hyva3: 5hyv A:532-677 [329552]
    Other proteins in same PDB: d5hyva1, d5hyva2
    automated match to d1gpua3
    complexed with 1pe, ca, tpp

Details for d5hyva3

PDB Entry: 5hyv (more details), 1.03 Å

PDB Description: crystal structure of transketolase with thdp from pichia stipitis
PDB Compounds: (A:) transketolase

SCOPe Domain Sequences for d5hyva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hyva3 c.48.1.0 (A:532-677) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
egssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltf
dkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpe
gvaeraaktvafykgkdvvsplrsaf

SCOPe Domain Coordinates for d5hyva3:

Click to download the PDB-style file with coordinates for d5hyva3.
(The format of our PDB-style files is described here.)

Timeline for d5hyva3:

  • d5hyva3 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09