SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t5xa2 (5t5x A:206-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003513Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2003514Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2003515Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 protein domains)
  6. 2003537Protein Cryptochrome C-terminal domain [81841] (3 species)
  7. 2003538Species Mouse (Mus musculus) [TaxId:10090] [226830] (2 PDB entries)
  8. 2286248Domain d5t5xa2: 5t5x A:206-491 [329549]
    Other proteins in same PDB: d5t5xa1
    automated match to d4k0ra2
    complexed with cl

Details for d5t5xa2

PDB Entry: 5t5x (more details), 1.84 Å

PDB Description: high resolution structure of mouse cryptochrome 1
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d5t5xa2:

Sequence, based on SEQRES records: (download)

>d5t5xa2 a.99.1.1 (A:206-491) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprmnansllasptglspylrfgclscrlf
yfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpe
alakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeell
ldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiy
dpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql

Sequence, based on observed residues (ATOM records): (download)

>d5t5xa2 a.99.1.1 (A:206-491) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanprmnansllasptglspylrfgclscrlfyfk
ltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpeala
kwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeelllda
dwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiydpw
napegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql

SCOPe Domain Coordinates for d5t5xa2:

Click to download the PDB-style file with coordinates for d5t5xa2.
(The format of our PDB-style files is described here.)

Timeline for d5t5xa2:

  • d5t5xa2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5t5xa1