Lineage for d5t5xa2 (5t5x A:206-491)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003513Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2003514Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) (S)
    automatically mapped to Pfam PF03441
  5. 2003515Family a.99.1.1: Cryptochrome/photolyase FAD-binding domain [48174] (3 protein domains)
  6. 2003537Protein Cryptochrome C-terminal domain [81841] (3 species)
  7. 2003538Species Mouse (Mus musculus) [TaxId:10090] [226830] (2 PDB entries)
  8. 2286248Domain d5t5xa2: 5t5x A:206-491 [329549]
    Other proteins in same PDB: d5t5xa1
    automated match to d4k0ra2
    complexed with cl

Details for d5t5xa2

PDB Entry: 5t5x (more details), 1.84 Å

PDB Description: high resolution structure of mouse cryptochrome 1
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d5t5xa2:

Sequence, based on SEQRES records: (download)

>d5t5xa2 a.99.1.1 (A:206-491) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanferprmnansllasptglspylrfgclscrlf
yfkltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpe
alakwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeell
ldadwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiy
dpwnapegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql

Sequence, based on observed residues (ATOM records): (download)

>d5t5xa2 a.99.1.1 (A:206-491) Cryptochrome C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ssavwpggetealtrlerhlerkawvanprmnansllasptglspylrfgclscrlfyfk
ltdlykkvkknsspplslygqllwreffytaatnnprfdkmegnpicvqipwdknpeala
kwaegrtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeelllda
dwsinagswmwlscssffqqffhcycpvgfgrrtdpngdyirrylpvlrgfpakyiydpw
napegiqkvakcligvnypkpmvnhaeasrlniermkqiyqql

SCOPe Domain Coordinates for d5t5xa2:

Click to download the PDB-style file with coordinates for d5t5xa2.
(The format of our PDB-style files is described here.)

Timeline for d5t5xa2:

  • d5t5xa2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5t5xa1