SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t5xa1 (5t5x A:3-205)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2106750Fold c.28: Cryptochrome/photolyase, N-terminal domain [52424] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2106751Superfamily c.28.1: Cryptochrome/photolyase, N-terminal domain [52425] (2 families) (S)
    automatically mapped to Pfam PF00875
  5. 2106752Family c.28.1.1: Cryptochrome/photolyase, N-terminal domain [52426] (3 protein domains)
  6. 2106753Protein Cryptochrome [82367] (3 species)
  7. 2106754Species Mouse (Mus musculus) [TaxId:10090] [226829] (2 PDB entries)
  8. 2286247Domain d5t5xa1: 5t5x A:3-205 [329548]
    Other proteins in same PDB: d5t5xa2
    automated match to d4k0ra1
    complexed with cl

Details for d5t5xa1

PDB Entry: 5t5x (more details), 1.84 Å

PDB Description: high resolution structure of mouse cryptochrome 1
PDB Compounds: (A:) Cryptochrome-1

SCOPe Domain Sequences for d5t5xa1:

Sequence, based on SEQRES records: (download)

>d5t5xa1 c.28.1.1 (A:3-205) Cryptochrome {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyildpwfagssnvginrwrfllqcledl
danlrklnsrlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagv
evivrishtlydldkiielnggqppltykrfqtlvskmeplempadtitsdvigkcmtpl
sddhdekygvpsleelgfdtdgl

Sequence, based on observed residues (ATOM records): (download)

>d5t5xa1 c.28.1.1 (A:3-205) Cryptochrome {Mouse (Mus musculus) [TaxId: 10090]}
vnavhwfrkglrlhdnpalkeciqgadtircvyilvginrwrfllqcledldanlrklns
rlfvirgqpadvfprlfkewnitklsieydsepfgkerdaaikklateagvevivrisht
lydldkiielnggqppltykrfqtlvskmepitsdvigkcmtplsddhdekygvpsleel
gfdtdgl

SCOPe Domain Coordinates for d5t5xa1:

Click to download the PDB-style file with coordinates for d5t5xa1.
(The format of our PDB-style files is described here.)

Timeline for d5t5xa1:

  • d5t5xa1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

2286247
d5t5xa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5t5xa2