SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mata1 (5mat A:56-356)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107583Protein automated matches [191258] (2 species)
    not a true protein
  7. 2107587Species Human (Homo sapiens) [TaxId:9606] [189817] (15 PDB entries)
  8. 2286243Domain d5mata1: 5mat A:56-356 [329544]
    Other proteins in same PDB: d5mata2, d5matc2
    automated match to d4rmha_
    complexed with 7kj, p6g, pg4, so4, zn

Details for d5mata1

PDB Entry: 5mat (more details), 2.07 Å

PDB Description: structure of human sirtuin 2 in complex with a selective thienopyrimidinone based inhibitor
PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d5mata1:

Sequence, based on SEQRES records: (download)

>d5mata1 c.31.1.5 (A:56-356) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdp
flgmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq
s

Sequence, based on observed residues (ATOM records): (download)

>d5mata1 c.31.1.5 (A:56-356) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrstglydnlekyhlpypea
ifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleriag
leqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivffge
slparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagqsdpfl
gmimglgggmdfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaqs

SCOPe Domain Coordinates for d5mata1:

Click to download the PDB-style file with coordinates for d5mata1.
(The format of our PDB-style files is described here.)

Timeline for d5mata1:

  • d5mata1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09

View in 3D
Domains from same chain:
(mouse over for more information)
d5mata2