SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ti1a2 (5ti1 A:138-436)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211128Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2211129Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2211213Family d.177.1.0: automated matches [191367] (1 protein)
    not a true family
  6. 2211214Protein automated matches [190444] (4 species)
    not a true protein
  7. 2286236Species Burkholderia xenovorans [TaxId:266265] [329537] (1 PDB entry)
  8. 2286242Domain d5ti1a2: 5ti1 A:138-436 [329543]
    Other proteins in same PDB: d5ti1a1, d5ti1b1, d5ti1c1, d5ti1d1, d5ti1e1, d5ti1f1, d5ti1g1, d5ti1h1
    automated match to d4qkud2
    complexed with mg, na, no3, po4

Details for d5ti1a2

PDB Entry: 5ti1 (more details), 2 Å

PDB Description: crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
PDB Compounds: (A:) fumarylacetoacetate hydrolase

SCOPe Domain Sequences for d5ti1a2:

Sequence, based on SEQRES records: (download)

>d5ti1a2 d.177.1.0 (A:138-436) automated matches {Burkholderia xenovorans [TaxId: 266265]}
vqipgytdfysskehatnvgsmfrdpknallpnwsempigyngrassvvvsgtpvrrpng
qlklpdqerpvfgacrkldieletgfvigagnalgepvtcadaeahifgmvllndwsard
iqqweyvplgpfnaktfattispwivtldalepfrvaqpaqdpqplaylrhdgehafdit
levtlrpqqakeastitrtnfkhmywtmaqqlahhtvsgcntrvgdlmgsgtisgpteds
fgslleltwngkkplelreggtrsfiedgdeltlagwcqgegyrvgfgvcageilpalk

Sequence, based on observed residues (ATOM records): (download)

>d5ti1a2 d.177.1.0 (A:138-436) automated matches {Burkholderia xenovorans [TaxId: 266265]}
vqipgytdfysskehatnvgsmfrdnallpnwsempigyngrassvvvsgtpvrrpngql
klpdqerpvfgacrkldieletgfvigagnalgepvtcadaeahifgmvllndwsardiq
qweyvplgpfnaktfattispwivtldalepfrvaqpaqdpqplaylrhdgehafditle
vtlrpqqakeastitrtnfkhmywtmaqqlahhtvsgcntrvgdlmgsgtisgptedsfg
slleltwngkkplelreggtrsfiedgdeltlagwcqgegyrvgfgvcageilpalk

SCOPe Domain Coordinates for d5ti1a2:

Click to download the PDB-style file with coordinates for d5ti1a2.
(The format of our PDB-style files is described here.)

Timeline for d5ti1a2:

  • d5ti1a2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09