SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t4ua_ (5t4u A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (8 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (589 PDB entries)
  8. 2286231Domain d5t4ua_: 5t4u A: [329532]
    automated match to d4lc2a_
    complexed with 12q, no3

Details for d5t4ua_

PDB Entry: 5t4u (more details), 1.5 Å

PDB Description: crystal structure of the bromodomain of human brpf1 in complex with a quinolinone ligand
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5t4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4ua_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm

SCOPe Domain Coordinates for d5t4ua_:

Click to download the PDB-style file with coordinates for d5t4ua_.
(The format of our PDB-style files is described here.)

Timeline for d5t4ua_:

  • d5t4ua_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09