SCOPe 2.06: Domain d5ht9b_: 5ht9 B:

Lineage for d5ht9b_ (5ht9 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Methanosarcina acetivorans [TaxId:188937] [329445] (1 PDB entry)

8. Domain d5ht9b_: 5ht9 B: [329531]
   automated match to d3hz2a_
   complexed with btb, mg, ni

Details for d5ht9b_

PDB Entry: 5ht9, 1.87 Å

PDB Description: crystal structure of m-crystallin in the presence of nickel

PDB Compounds: (B:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d5ht9b_:

Sequence; same for both SEQRES and ATOM records:

>d5ht9b_ b.11.1.0 (B:) automated matches {Methanosarcina acetivorans [TaxId: 188937]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

Timeline for d5ht9b_:

• d5ht9b_ is new in SCOPe 2.06-stable
  
• d5ht9b_ appears in SCOPe 2.07
  
• d5ht9b_ appears in the current release, SCOPe 2.08