SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ht9b_ (5ht9 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038595Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2038596Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2038718Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2038719Protein automated matches [191109] (11 species)
    not a true protein
  7. 2286144Species Methanosarcina acetivorans [TaxId:188937] [329445] (1 PDB entry)
  8. 2286230Domain d5ht9b_: 5ht9 B: [329531]
    automated match to d3hz2a_
    complexed with btb, mg, ni

Details for d5ht9b_

PDB Entry: 5ht9 (more details), 1.87 Å

PDB Description: crystal structure of m-crystallin in the presence of nickel
PDB Compounds: (B:) Beta/gama crystallin family protein

SCOPe Domain Sequences for d5ht9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ht9b_ b.11.1.0 (B:) automated matches {Methanosarcina acetivorans [TaxId: 188937]}
naaevivyehvnfggksfdatsdqpgagdnlndkissikvksgtwrfyeyinyggrywdl
gpgeyssvesagipdnsissfrqi

SCOPe Domain Coordinates for d5ht9b_:

Click to download the PDB-style file with coordinates for d5ht9b_.
(The format of our PDB-style files is described here.)

Timeline for d5ht9b_:

  • d5ht9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09