Lineage for d1gscc2 (1gsc C:1-84)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70930Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)
  6. 70934Protein Glutathione S-transferase [52863] (24 species)
  7. 71144Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 71175Domain d1gscc2: 1gsc C:1-84 [32953]
    Other proteins in same PDB: d1gsca1, d1gscb1, d1gscc1, d1gscd1

Details for d1gscc2

PDB Entry: 1gsc (more details), 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gscc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gscc2 c.47.1.5 (C:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d1gscc2:

Click to download the PDB-style file with coordinates for d1gscc2.
(The format of our PDB-style files is described here.)

Timeline for d1gscc2: