SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t4va_ (5t4v A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (8 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (387 PDB entries)
  8. 2286227Domain d5t4va_: 5t4v A: [329528]
    automated match to d4lc2a_
    complexed with edo, fmt, n48

Details for d5t4va_

PDB Entry: 5t4v (more details), 1.65 Å

PDB Description: crystal structure of the bromodomain of human brpf1 in complex with ni-48 ligand
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5t4va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4va_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayry
lnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm

SCOPe Domain Coordinates for d5t4va_:

Click to download the PDB-style file with coordinates for d5t4va_.
(The format of our PDB-style files is described here.)

Timeline for d5t4va_:

  • d5t4va_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09