SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hwaa_ (5hwa A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2154439Family d.2.1.7: Chitosanase [53996] (2 protein domains)
    automatically mapped to Pfam PF01374
  6. 2154440Protein Endochitosanase [53997] (2 species)
  7. 2154441Species Bacillus circulans [TaxId:1397] [53999] (3 PDB entries)
  8. 2286226Domain d5hwaa_: 5hwa A: [329527]
    automated match to d1qgia_
    complexed with acy, cac, gcs, zn

Details for d5hwaa_

PDB Entry: 5hwa (more details), 1.35 Å

PDB Description: crystal structure of mh-k1 chitosanase in substrate-bound form
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d5hwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwaa_ d.2.1.7 (A:) Endochitosanase {Bacillus circulans [TaxId: 1397]}
aspddnfspetlqflrnntgldgeqwnnimklinkpqqddlnwikyygycediedergyt
iglfgattggsrdthpdgpdlfkaydaakgasnpsadgalkrlgingkmkgsileikdse
kvfcgkikklqndaawrkamwetfynvyirysveqarqrgftsavtigsfvdtalnqgat
ggsdtlqgllarsgsssnektfmknfhakrtlvvdtnkynkppngknrvkqwdtlvdmgk
mnlknvdseiaqvtdwemk

SCOPe Domain Coordinates for d5hwaa_:

Click to download the PDB-style file with coordinates for d5hwaa_.
(The format of our PDB-style files is described here.)

Timeline for d5hwaa_:

  • d5hwaa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09