Lineage for d5hwaa_ (5hwa A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2154439Family d.2.1.7: Chitosanase [53996] (2 protein domains)
    automatically mapped to Pfam PF01374
  6. 2154440Protein Endochitosanase [53997] (2 species)
  7. 2154441Species Bacillus circulans [TaxId:1397] [53999] (3 PDB entries)
  8. 2286226Domain d5hwaa_: 5hwa A: [329527]
    automated match to d1qgia_
    complexed with acy, cac, gcs, zn

Details for d5hwaa_

PDB Entry: 5hwa (more details), 1.35 Å

PDB Description: crystal structure of mh-k1 chitosanase in substrate-bound form
PDB Compounds: (A:) Chitosanase

SCOPe Domain Sequences for d5hwaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwaa_ d.2.1.7 (A:) Endochitosanase {Bacillus circulans [TaxId: 1397]}
aspddnfspetlqflrnntgldgeqwnnimklinkpqqddlnwikyygycediedergyt
iglfgattggsrdthpdgpdlfkaydaakgasnpsadgalkrlgingkmkgsileikdse
kvfcgkikklqndaawrkamwetfynvyirysveqarqrgftsavtigsfvdtalnqgat
ggsdtlqgllarsgsssnektfmknfhakrtlvvdtnkynkppngknrvkqwdtlvdmgk
mnlknvdseiaqvtdwemk

SCOPe Domain Coordinates for d5hwaa_:

Click to download the PDB-style file with coordinates for d5hwaa_.
(The format of our PDB-style files is described here.)

Timeline for d5hwaa_:

  • d5hwaa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-09