SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m1aa3 (5m1a A:328-668)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2218404Protein Penicillin binding protein 2a (PBP2A), C-terminal domain [82838] (1 species)
  7. 2218405Species Staphylococcus aureus [TaxId:1280] [82839] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2286220Domain d5m1aa3: 5m1a A:328-668 [329521]
    Other proteins in same PDB: d5m1aa1, d5m1aa2, d5m1ab1, d5m1ab2
    automated match to d1vqqa3
    complexed with cd, mur

Details for d5m1aa3

PDB Entry: 5m1a (more details), 2 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of ceftazidime ligand
PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m1aa3:

Sequence, based on SEQRES records: (download)

>d5m1aa3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Sequence, based on observed residues (ATOM records): (download)

>d5m1aa3 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmktgrqigwfisydkdnpnmmma
invkdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d5m1aa3:

Click to download the PDB-style file with coordinates for d5m1aa3.
(The format of our PDB-style files is described here.)

Timeline for d5m1aa3:

  • d5m1aa3 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09