Lineage for d5m1aa2 (5m1a A:139-327)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210992Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2210993Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2210994Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 protein domains)
    contains an insert subdomain of ClpS-like fold
  6. 2210995Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 2210996Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2286219Domain d5m1aa2: 5m1a A:139-327 [329520]
    Other proteins in same PDB: d5m1aa1, d5m1aa3, d5m1ab1, d5m1ab3
    automated match to d1vqqa2
    complexed with cd, mur

Details for d5m1aa2

PDB Entry: 5m1a (more details), 2 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of ceftazidime ligand
PDB Compounds: (A:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m1aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m1aa2 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d5m1aa2:

Click to download the PDB-style file with coordinates for d5m1aa2.
(The format of our PDB-style files is described here.)

Timeline for d5m1aa2:

  • d5m1aa2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09