SCOP 1.57: Domain d1gscb2: 1gsc B:1-84

Lineage for d1gscb2 (1gsc B:1-84)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)

8. Domain d1gscb2: 1gsc B:1-84 [32952]
   Other proteins in same PDB: d1gsca1, d1gscb1, d1gscc1, d1gscd1

Details for d1gscb2

PDB Entry: 1gsc, 2.5 Å

PDB Description: new crystal forms of a mu class glutathione s-transferase from rat liver

SCOP Domain Sequences for d1gscb2:

Sequence; same for both SEQRES and ATOM records:

>d1gscb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d1gscb2:

• d1gscb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gscb2 appears in SCOP 1.59
  
• d1gscb2 appears in the current release, SCOPe 2.08