Lineage for d2ndoa_ (2ndo A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133602Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2133603Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2133613Species Escherichia coli [TaxId:562] [100955] (17 PDB entries)
  8. 2133642Domain d2ndoa_: 2ndo A: [329517]
    automated match to d1a23a_
    complexed with sfq

Details for d2ndoa_

PDB Entry: 2ndo (more details)

PDB Description: structure of ecdsba-sulfonamide1 complex
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2ndoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ndoa_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsekk

SCOPe Domain Coordinates for d2ndoa_:

Click to download the PDB-style file with coordinates for d2ndoa_.
(The format of our PDB-style files is described here.)

Timeline for d2ndoa_: