SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ndoa_ (2ndo A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118739Family c.47.1.13: DsbA-like [100953] (4 protein domains)
    contains an all-alpha subdomain insertion
  6. 2118740Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2118750Species Escherichia coli [TaxId:562] [100955] (17 PDB entries)
  8. 2286216Domain d2ndoa_: 2ndo A: [329517]
    automated match to d1a23a_
    complexed with sfq

Details for d2ndoa_

PDB Entry: 2ndo (more details)

PDB Description: structure of ecdsba-sulfonamide1 complex
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d2ndoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ndoa_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsekk

SCOPe Domain Coordinates for d2ndoa_:

Click to download the PDB-style file with coordinates for d2ndoa_.
(The format of our PDB-style files is described here.)

Timeline for d2ndoa_:

  • d2ndoa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08