SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m4ye1 (5m4y E:36-227)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1997864Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 1997877Superfamily a.47.2: t-snare proteins [47661] (1 family) (S)
  5. 1997878Family a.47.2.1: t-snare proteins [47662] (6 protein domains)
  6. 1997902Protein automated matches [191190] (4 species)
    not a true protein
  7. 2286207Species Saccharomyces cerevisiae [TaxId:559292] [329508] (2 PDB entries)
  8. 2286208Domain d5m4ye1: 5m4y E:36-227 [329509]
    Other proteins in same PDB: d5m4ya2, d5m4yc2, d5m4ye2
    automated match to d1fioa_
    complexed with gol

Details for d5m4ye1

PDB Entry: 5m4y (more details), 2.2 Å

PDB Description: crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution
PDB Compounds: (E:) Protein SSO2

SCOPe Domain Sequences for d5m4ye1:

Sequence, based on SEQRES records: (download)

>d5m4ye1 a.47.2.1 (E:36-227) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
dfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqatdlq
yqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqytii
qpeatdeeveaaindvngqqifsqallnanrrgeaktalaevqarhqellklektmaelt
qlfndmeelvie

Sequence, based on observed residues (ATOM records): (download)

>d5m4ye1 a.47.2.1 (E:36-227) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
dfvafmnkinsinanlsryeniinqidaqhkdlltqvseeqemelrrslddyisqatdlq
yqlkadikdaqrdglhdsnkqaqaencrqkflkliqdyriidsnykeeskeqakrqytii
qpeatdeeveaaindvngqqaktalaevqarhqellklektmaeltqlfndmeelvie

SCOPe Domain Coordinates for d5m4ye1:

Click to download the PDB-style file with coordinates for d5m4ye1.
(The format of our PDB-style files is described here.)

Timeline for d5m4ye1:

  • d5m4ye1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09