Lineage for d5mace1 (5mac E:2-139)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2175267Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2175463Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2175464Protein automated matches [226983] (18 species)
    not a true protein
  7. 2286205Species Methanococcoides burtonii [TaxId:29291] [329506] (1 PDB entry)
  8. 2286206Domain d5mace1: 5mac E:2-139 [329507]
    automated match to d3a13d1
    complexed with cap, cl, mg

Details for d5mace1

PDB Entry: 5mac (more details), 2.6 Å

PDB Description: crystal structure of decameric methanococcoides burtonii rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (E:) Ribulose-1,5-bisphosphate carboxylase-oxygenase type III

SCOPe Domain Sequences for d5mace1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mace1 d.58.9.0 (E:2-139) automated matches {Methanococcoides burtonii [TaxId: 29291]}
sliyedlvksldskqqayvdlklpdptngefllavfhmipggdlnvlqaaaeiaaesstg
tnikvstetafsrtmnarvyqldlerelvwiaypwrlfdrggnvqniltyiignilgmke
iqalklmdiwfppsmleq

SCOPe Domain Coordinates for d5mace1:

Click to download the PDB-style file with coordinates for d5mace1.
(The format of our PDB-style files is described here.)

Timeline for d5mace1:

  • d5mace1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09