SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m18b2 (5m18 B:139-327)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210992Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
    unusual fold
  4. 2210993Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) (S)
    automatically mapped to Pfam PF03717
  5. 2210994Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 protein domains)
    contains an insert subdomain of ClpS-like fold
  6. 2210995Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
    the insert subdomain (residues 168-239) is fully ordered
  7. 2210996Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
    Uniprot O54286 27-668
  8. 2286201Domain d5m18b2: 5m18 B:139-327 [329502]
    Other proteins in same PDB: d5m18a1, d5m18a3, d5m18b1, d5m18b3
    automated match to d1vqqa2
    complexed with cd, mur

Details for d5m18b2

PDB Entry: 5m18 (more details), 1.98 Å

PDB Description: crystal structure of pbp2a from mrsa in the presence of cefepime ligand
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5m18b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m18b2 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplgkatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

SCOPe Domain Coordinates for d5m18b2:

Click to download the PDB-style file with coordinates for d5m18b2.
(The format of our PDB-style files is described here.)

Timeline for d5m18b2:

  • d5m18b2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-09