SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jw9b_ (5jw9 B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2239862Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2239993Superfamily h.4.17: occludin/ELL-like [144292] (2 families) (S)
    antiparallel hairpin with a kinked second helix; similar to the N-terminal structure of the thermostable carboxypeptidase 1 (82731)
  5. 2286196Family h.4.17.0: automated matches [329497] (1 protein)
    not a true family
  6. 2286197Protein automated matches [329498] (1 species)
    not a true protein
  7. 2286198Species Homo sapiens [TaxId:9606] [329499] (1 PDB entry)
  8. 2286199Domain d5jw9b_: 5jw9 B: [329500]
    automated match to d1wpaa1

Details for d5jw9b_

PDB Entry: 5jw9 (more details), 2 Å

PDB Description: the crystal structure of ell2 oclludin domain and aff4 peptide
PDB Compounds: (B:) RNA polymerase II elongation factor ELL2

SCOPe Domain Sequences for d5jw9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jw9b_ h.4.17.0 (B:) automated matches {Homo sapiens [TaxId: 9606]}
lpdylikyiaivsyeqrqnykddfnaeydeyralharmetvarrfikldaqrkrlspgsk
eyqnvheevlqeyqkikqsspnyheekyrceylhnklahikrmigefdqqqaesw

SCOPe Domain Coordinates for d5jw9b_:

Click to download the PDB-style file with coordinates for d5jw9b_.
(The format of our PDB-style files is described here.)

Timeline for d5jw9b_:

  • d5jw9b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-08